Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_073760F:1-172 073760F_061290_eq Sc0000031:1764674-1771073(+) ssr4 signal sequence receptor, delta

 Link to be detailed in other pages:
 [transcript: Bb_073760F] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR008855  13-172  2.1E-57  Translocon-associated

MASWTKMFALFSLVLLFFCSSNAQTCVGPTVEATSFTSAEANLAMETTFLVEFTLSCKNAAKDLVLHADIGDRQFPVSRSADGMRYQISWTAEHKQAPAG
SYEVRFFDDEGFAALRKAQRSDQDVNAVSSLFTITVHHRGVSQGPWASSPTVAAVAAFAVWLFAYRAKRQIQ


 
Jan 11, 2021. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.