Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
  
 Searching for Transcripts 
[Help]  
 
Zebrafish
Danio rerio
 Database: for
 Tips for searching: search using a ID, gene name, symbols or description variable in publications and databases.
 Searching examples: ssr4, ssr, hox, TLR, caspase, also Bb_073760F are available for query.
 

 1. Transcript Detail [Help]   
 Transcript Mapping
 Exons Structure     

Gene id: ENSDARG00000007358 
Gene name: cxcr3.1
Chromosome: chr16(-)
Gene locus: chr16(-):13603464-13609316
Gene description: chemokine (C-X-C motif) receptor 3.1 [Source:ZFIN;Acc:ZDB-GENE-060130-38 ]

Transcript id: ENSDART00000145754 
Transcript name: cxcr3.1-001
Transcript locus: chr16(-):13603464-13609316

Start codon: 13608011
Stop codon: 13604933
Alternative polyA sites: Mapped to the searched transcript (containing the 5' and 3' flanking region of 1kb).
13596199, 13590133, 13589653, 13589617, 13588415, 13535291, 13530754, 13510989, 13510597, 13462675, 13462216
polyA signals: AATAAA, AATAAA, ATTAAA, ACTAAA, TATAAA, AATAAA, CATAAA, AATAAA, AATAAA, AATAAA, ATTAAA

Notes:
mRNA/CDS:
  mRNA/CDS sequence ( exon splicing-sites gapped by the sympol ' / ' )     
>ENSDART00000145754 2615bp 
AGCACCTCTCAACCTCTGCGTGATCACTTACAAAGGTAT/TGAATGTTGACTCAAAAACAACATTCAGTATGAAGGATTTCAGTGACTACACAGACCTTTACAATTACAGTGACTACAATGACAATGAAAGCTATGGCGCAGGAGCTGTGTGCACTCAAGACTCCAGCATGTACTTTGACAGCATTTTTAAGCCAATCCTTTACTCACTGGCAGCGGTCGTGGGGCTGCTGGGAAACGGCTTGGTTCTGATTGTACTGTGGAAGAAGAGAGCAGGTTTGAATGTTACAGACATCTTCATCCTCCACCTGAGCCTGGCAGATATTTTGCTGCTGTTAACACTGCCCTTCTGGGCTGTAGAGGCGGTGAAGGAGTGGATCTTTGGCACACCACTTTGCAAACTGACTGGAGCTATGTTCAGGGTGA/ATTTCTACTGTGGCATTTACATGCTTTCCTGCATCAGTCTCGACCGCTACCTGTCCATCGTCCATGCAGTCCAAATGTACTCCCGTAAAAAGCCCATGGCGGTTCACTGTTGCTGCATGATAGTCTGGTTCTTCTGCTTTCTGCTCTCCATTCCCGATTGGATATTACTTGGTGCCAACAAGGACTCCAGACGTCAGGATAGAACAGAATGTGTTAATTCAGAAGCTCTATCTGATTTTTGGGTTCTGGTCAATCGTCTGATCTATCATTTTTTGGGTTTCATTATTCCAGCAATAATGATGGTCTTCTGCTACACTAGCATTCTGCTGCGCTTACTGCTCGGCTCCAAGTGCATGCAGAAGAAGAGGGCCATCCATGTCATTGTAGCCCTGGTACTGGCCTTCTTCATCAGCTGGACGCCCTACAACATCGCCCTCATGGCTGACACCATACATACCAACAGGACTGACAATAACCAAACGTCCTGCGAGACCAGAACCACGTTGGATGTTGCGATCACAGCCACTTCAACATTTGCCTACATGCACTGCTGTGTCAACCCAATTCTTTATGCTTTTGTGGGGGTGAAATTTCGTCAGCACCTGCTAGACATGCTACGACCTCTGGGCTTCAAGCTGAAGGGCCGCGCAGGCCTGGTTTCTCGGAAGAGCTCGGGATGGTCAGAGTCGGTGGACACTTCCCACACATCTGCTTTCTGAAGCATCAAATGCCATCAGACCATTACAGTATCTTTTCCTGTAATTGTTAACAAACATTGTTGTATTATGCAAGAGGAATCAAGAACTCAGGCGTTGTCGTTCACACCAATGACAATGACTAACAAAAGGAAAAAAGTCAGAAAAAAGTATTAGAGCTAATGGCATAAGTACCCTAATTTTGATGTGTTTACCCAGCAGGAATTGGGAATGATTTTAGTTATAGAAATCACCATTGAGGGAACTAAAAAATCACCTACTTCAAAAAATCCAGGTCTAATCCAGCTCAACTGGAACTACAACTGACATTAGTGTACACAGATTGGGTAAATGGCATGTCATACAAAATACACAGTATTTTAAAGTGTTACAAGACACATACTTGGTCTCGATGATACAGTATGTACCATTTCAAGTTGTCATATTTTGTCTCTCATTCTAATTTAGTTCTTTCAGTCACATATCTTATACGAGTATGTTCCATTTCTATTATTATGACATACACAAAATTCAAATAGAGTCCTTTGTGATTAAAAAACGACCCTAATAATTACAATTAGGACAACGGTCTAAGATGAAAATGTAGTTATTAGAGACTTTATCTTTTTTTTTCGTCACACTCATGTGATCGAAGTGTTGTGAATGTTTTGTTGAGGTGTTTTTGGTTAAAATGTGTGTAATATTGATCATTTTGAAATTTTCGCTATAGAGAAAAAATGTAGACATGTTTAGATAGACGATCTATCTATTTCACTCTAAGACTCCAAACACAGCTGTCCTCTGACAACAGAGGAATAAAATCAATGGCTAAAACAATCATACAACATCGTCAACTTCTGTTTTGGAGGTTAATGTTACTTTAGTTTTAATAAACATCGTTATTATACGTGGTTTGAGCCAGTTTTTAATGTCGAGACTGTGCTGATTAATACGCAGAATGTTTTAAAACATGAATTTAGATGTTTAAGCTCTTCACATGTGGCAGCTACCATAGGTTTTCAACTGTTTAGCTTTCTCAAGCATATTGATTGCCTGCGACTTTGGACAGAGATCAAAGTTATATTACGTTAAAATAGATCACTTTCAATTACTCAACTGGATAATGATTTTGAAAAATTGTGGGAAGCTGAAGTTTATATATTTTTAATATTTACTTTTTTATATATATTTTTTACTTTTTTATATTATTCATTATGCTTTGGAGTTTTTTATGTATTGTTTAGTAATGCTTTCTTGATATTTACTGTATGATGTTCTATTTTTTCGGTATCTTTCTTTGCTGTACATACATTTTAAAAAATCTTTTACATAATAATATGAAATAGTACCGCCAGATATACATATTGGTTTTTAATATCTGTTTTTACTTTGATATATAACATTTTCATTTGTGCTTGCATTAATCTTGTATCTATGAGGTCTGTCTCATTAATGCTGTAAAACTGCAGTACAATAAAACAGAAGCAAAATGGCTAC
Protein product:
  Amino acids sequence (deduced by the coding sequence)  
>ENSDART00000145754 cxcr3.1-001 368aa
MLTQKQHSV*RISVTTQTFTITVTTMTMKAMAQELCALKTPACTLTAFLSQSFTHWQRSWGCWETAWF*LYCGRREQV*MLQTSSSST*AWQIFCCC*HCPSGL*RR*RSGSLAHHFAN*LELCSG*ISTVAFTCFPASVSTATCPSSMQSKCTPVKSPWRFTVAA**SGSSAFCSPFPIGYYLVPTRTPDVRIEQNVLIQKLYLIFGFWSIV*SIIFWVSLFQQ**WSSATLAFCCAYCSAPSACRRRGPSMSL*PWYWPSSSAGRPTTSPSWLTPYIPTGLTITKRPARPEPRWMLRSQPLQHLPTCTAVSTQFFMLLWG*NFVSTC*TCYDLWASS*RAAQAWFLGRARDGQSRWTLPTHLLSEA
Citation:
(Leiming You, et al. Nucleic Acids Res. 2015, 43: D59-D67) APASdb: a database describing alternative poly(A) sites and selection of heterogeneous cleavage sites downstream of poly(A) signals.

 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.