Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
  
 Searching for Transcripts 
[Help]  
 
Zebrafish
Danio rerio
 Database: for
 Tips for searching: search using a ID, gene name, symbols or description variable in publications and databases.
 Searching examples: ssr4, ssr, hox, TLR, caspase, also Bb_073760F are available for query.
 

 1. Transcript Detail [Help]   
 Transcript Mapping
 Exons Structure     

Gene id: ENSDARG00000078729 
Gene name: ccrl1a
Chromosome: chr2(+)
Gene locus: chr2(+):31387267-31390125
Gene description: chemokine (C-C motif) receptor-like 1a [Source:ZFIN;Acc:ZDB-GENE-070301-6 ]

Transcript id: ENSDART00000145446 
Transcript name: ccrl1a-001
Transcript locus: chr2(+):31387267-31390125

Start codon:
Stop codon: 31390123
Alternative polyA sites: Mapped to the searched transcript (containing the 5' and 3' flanking region of 1kb).
31391121
polyA signals: AATAAA

Notes:
mRNA/CDS:
  mRNA/CDS sequence ( exon splicing-sites gapped by the sympol ' / ' )     
>ENSDART00000145446 1150bp 
GACAGAAACGATCCACTCTGCCTTCAGGCAAAGCTTCAACCCTTTCGAG/AGAATGGAGAACTCCGAGGAGCATTTCTACGATTACCCAGAGTATGAAAACAGCAGCTCTAACTTCAGCTATGATGACTATCAGACCATCTGCGAGAAAGGCGACGTTCGCTCCTTTGCAAGAATCTTCCTCCCAGCTGTTTTTGGCTTATCTCTAGTGATTGGTTTAGCAGGCAATGCTCTGATTGTGGCAGTCTATGCATACTGCAAGCAACTGAAAACAATGACTGACACATTTATACTCCACCTGGCAGTTGCAGACCTTCTCTTGCTCCTAACGTTGCCCTTTTGGGCAGTCGATGCGGTCCATGGCTGGCAGCTCGGGATAACCATCTGTAAACTCGTATCTGGTCTGTACACCATCAACTTCACCTGTAGCATGATGCTTTTGGCCTACATCAGCATGGATCGGTATTTGGCATTGTCGGTGGGATCCAGAAACCAAGGCCTTGGACGTGTTTTTCAAAAGCAGCATTGTGGAAAACTCTGTGTGGTGGTTTGGATGGCTGCGTTTCTTCTCGGCATCCCTGATTTGGTGTTTTCAACAGTCAGAGAACTCCCTCATAAAAAAAGCTGCCTTGCGATGTATCCGTCAGACATGGCGCTCAGGGCTAAAGCTAGTTTGGAAATGGTGGAGGTAGTGATTGGGTTTCTGCTACCTTTACTAGTGATGTTGTTCTGCTACACCCGTGTAGGTCGAGCTCTGCTGAAGCTCTCAGAGGATAGAAAGTGGAAGAAGTGGCAGTACATCCGTGTTTTGCTGGCGATGGTGGGAGTTTTCCTGGTCACGCAGTTGCCCTACAATGTGGTTAAGTTCTGCCGGGCTTTAGATATCATGTATACATTTGTCACTCACTGTGGGGTTAGTAAAAAGCTGGATTGGGCTACTCAGATCACAGAGAGCTTGGCACTTACGCACTGCTGTCTAAATCCTGTTGTATATACTTTCGTTGGTTCCTCCTTCAGACAGCATGTTTTGAAGTGTGCCAAAGACTTTGGAGACAGAGGAAGGAGGTTGGCACATGCGAGGGAGCAACAGGAAGTAAATATTTCATTGAATTCTCATTCGCACTCCCGAGACACCAGCACTTTCTCCATTTGA
Protein product:
  Amino acids sequence (deduced by the coding sequence)  
partial protein sequence
frame:+1 383aa

DRNDPLCLQAKLQPFRENGELRGAFLRLPRV*KQQL*LQL**LSDHLRERRRSLLCKNLPPSCFWLISSDWFSRQCSDCGSLCILQATENND*HIYTPPGSCRPSLAPNVALLGSRCGPWLAARDNHL*TRIWSVHHQLHL*HDAFGLHQHGSVFGIVGGIQKPRPWTCFSKAALWKTLCGGLDGCVSSRHP*FGVFNSQRTPS*KKLPCDVSVRHGAQG*S*FGNGGGSDWVSATFTSDVVLLHPCRSSSAEALRG*KVEEVAVHPCFAGDGGSFPGHAVALQCG*VLPGFRYHVYICHSLWG**KAGLGYSDHRELGTYALLSKSCCIYFRWFLLQTACFEVCQRLWRQRKEVGTCEGATGSKYFIEFSFALPRHQHFLHL
frame:+2 383aa
TETIHSAFRQSFNPFERMENSEEHFYDYPEYENSSSNFSYDDYQTICEKGDVRSFARIFLPAVFGLSLVIGLAGNALIVAVYAYCKQLKTMTDTFILHLAVADLLLLLTLPFWAVDAVHGWQLGITICKLVSGLYTINFTCSMMLLAYISMDRYLALSVGSRNQGLGRVFQKQHCGKLCVVVWMAAFLLGIPDLVFSTVRELPHKKSCLAMYPSDMALRAKASLEMVEVVIGFLLPLLVMLFCYTRVGRALLKLSEDRKWKKWQYIRVLLAMVGVFLVTQLPYNVVKFCRALDIMYTFVTHCGVSKKLDWATQITESLALTHCCLNPVVYTFVGSSFRQHVLKCAKDFGDRGRRLAHAREQQEVNISLNSHSHSRDTSTFSI*
frame:+3 383aa
QKRSTLPSGKASTLSREWRTPRSISTITQSMKTAALTSAMMTIRPSARKATFAPLQESSSQLFLAYL**LV*QAML*LWQSMHTASN*KQ*LTHLYSTWQLQTFSCS*RCPFGQSMRSMAGSSG*PSVNSYLVCTPSTSPVA*CFWPTSAWIGIWHCRWDPETKALDVFFKSSIVENSVWWFGWLRFFSASLIWCFQQSENSLIKKAALRCIRQTWRSGLKLVWKWWR**LGFCYLY**CCSATPV*VELC*SSQRIESGRSGSTSVFCWRWWEFSWSRSCPTMWLSSAGL*ISCIHLSLTVGLVKSWIGLLRSQRAWHLRTAV*ILLYILSLVPPSDSMF*SVPKTLETEEGGWHMRGSNRK*IFH*ILIRTPETPALSPF?
Citation:
(Leiming You, et al. Nucleic Acids Res. 2015, 43: D59-D67) APASdb: a database describing alternative poly(A) sites and selection of heterogeneous cleavage sites downstream of poly(A) signals.

 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.