Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
  
 Searching for Transcripts 
[Help]  
 
Zebrafish
Danio rerio
 Database: for
 Tips for searching: search using a ID, gene name, symbols or description variable in publications and databases.
 Searching examples: ssr4, ssr, hox, TLR, caspase, also Bb_073760F are available for query.
 

 1. Transcript Detail [Help]   
 Transcript Mapping
 Exons Structure     

Gene id: ENSDARG00000069160 
Gene name: fam19a5
Chromosome: chr4(-)
Gene locus: chr4(-):26548795-26561546
Gene description: family with sequence similarity 19 (chemokine (C-C motif)-like), member A5 [Source:ZFIN;Acc:ZDB-GENE-041210-344 ]

Transcript id: ENSDART00000139095 
Transcript name: si:dkey-27f18.1-003
Transcript locus: chr4(-):26548795-26561546

Start codon:
Stop codon:
Alternative polyA sites: Mapped to the searched transcript (containing the 5' and 3' flanking region of 1kb).
26548803, 26548667, 26548255
polyA signals: ATTAAA, none, multi

Notes:
mRNA/CDS:
  mRNA/CDS sequence ( exon splicing-sites gapped by the sympol ' / ' )     
>ENSDART00000139095 928bp 
TAGAGGATGAAGAGTGTGACTTGTTAGTAAATAAATCTGGCTGGACTTGTACACAGCCAAGTGGCAGAGTGAAAACTACAACG/GTGTCCTAACAGTGGGAGGGGTTCCTGGAGCGCTACCAGACAAGGCCTCTTGCAGATTTGCCCACCTGCTGTAGATACTTGCTATGTCTCATCGGCTTGACACCTGCCTCTGCCTACCAGTCTGCGTCTCAGCTTTGTAAATGGGCAGTACCCCCTTGTGCCACGGAGAGCATACTAGATGTTCACAAAGCGCCTCATGGACAGCAGCAGCCTTGAGGAATTTATGAGCGACTCTGAGGCACCTACCCTGTTTGAGACTGAACCAAACATAGGCTTTTTTGGGACTCCACCAGCGGTTCTGACCTAGACTGTGAACCAAGCCGCTTTTTGAACTGCTTTCTGCTGAAGTACATTTTTGCCACTCATTTTTACAGACCAAAGAGGAAAAAATAATGATATAATACAGAAATTTAAAAAAATCCATTGACTATGTTAGCACGGACTGAGAGACAGACTTGAAACGATTAAGACGGTGAAAAAAATATATATATACCTAAATGTAGAGAGGTAGATATAGATCTATGAAGACTTTGCTATACAGCGGCGGTCTACAAGCAAAAATGCTGACATGGAACACTGAAACGACTGGGTTGACCATTCCCATTTATCACAATCTGATGAGAACCTTTAATATTTTACAGATTTCCTTGAAAGGAACTACCCACTGCATTTCAAGGACAGCTAGGATATAGATACTGTACACAATCACATCAACAAATTTGTTTAGCATTTTTCAGTAGCAACATTTTGGACAGTTTGCATTCAGCATGGAAGGTTAAATGGAACCGTACCCCATTGTTTATCGTCAGAAGATATTAAACAAGAACATGAAAACTGTCATTTCT
Protein product:
  Amino acids sequence (deduced by the coding sequence)  
partial protein sequence
frame:+1 309aa

*RMKSVTC**INLAGLVHSQVAE*KLQRCPNSGRGSWSATRQGLLQICPPAVDTCYVSSA*HLPLPTSLRLSFVNGQYPLVPRRAY*MFTKRLMDSSSLEEFMSDSEAPTLFETEPNIGFFGTPPAVLT*TVNQAAF*TAFC*STFLPLIFTDQRGKNNDIIQKFKKIH*LC*HGLRDRLETIKTVKKIYIYLNVER*I*IYEDFAIQRRSTSKNADMEH*NDWVDHSHLSQSDENL*YFTDFLERNYPLHFKDS*DIDTVHNHINKFV*HFSVATFWTVCIQHGRLNGTVPHCLSSEDIKQEHENCHF
frame:+2 309aa
RG*RV*LVSK*IWLDLYTAKWQSENYNGVLTVGGVPGALPDKASCRFAHLL*ILAMSHRLDTCLCLPVCVSAL*MGSTPLCHGEHTRCSQSASWTAAALRNL*ATLRHLPCLRLNQT*AFLGLHQRF*PRL*TKPLFELLSAEVHFCHSFLQTKEEKIMI*YRNLKKSIDYVSTD*ETDLKRLRR*KKYIYT*M*RGRYRSMKTLLYSGGLQAKMLTWNTETTGLTIPIYHNLMRTFNILQISLKGTTHCISRTARI*ILYTITSTNLFSIFQ*QHFGQFAFSMEG*MEPYPIVYRQKILNKNMKTVIS
frame:+3 309aa
EDEECDLLVNKSGWTCTQPSGRVKTTTVS*QWEGFLERYQTRPLADLPTCCRYLLCLIGLTPASAYQSASQLCKWAVPPCATESILDVHKAPHGQQQP*GIYERL*GTYPV*D*TKHRLFWDSTSGSDLDCEPSRFLNCFLLKYIFATHFYRPKRKK**YNTEI*KNPLTMLARTERQT*ND*DGEKNIYIPKCREVDIDL*RLCYTAAVYKQKC*HGTLKRLG*PFPFITI**EPLIFYRFP*KELPTAFQGQLGYRYCTQSHQQICLAFFSSNILDSLHSAWKVKWNRTPLFIVRRY*TRT*KLSF?
Citation:
(Leiming You, et al. Nucleic Acids Res. 2015, 43: D59-D67) APASdb: a database describing alternative poly(A) sites and selection of heterogeneous cleavage sites downstream of poly(A) signals.

 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.