Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
  
 Searching for Transcripts 
[Help]  
 
Zebrafish
Danio rerio
 Database: for
 Tips for searching: search using a ID, gene name, symbols or description variable in publications and databases.
 Searching examples: ssr4, ssr, hox, TLR, caspase, also Bb_073760F are available for query.
 

 1. Transcript Detail [Help]   
 Transcript Mapping
 Exons Structure     

Gene id: ENSDARG00000090890 
Gene name: cmklr1
Chromosome: chr5(+)
Gene locus: chr5(+):22372800-22374123
Gene description: chemokine-like receptor 1 [Source:ZFIN;Acc:ZDB-GENE-060526-126 ]

Transcript id: ENSDART00000130911 
Transcript name: cmklr1-201
Transcript locus: chr5(+):22372800-22374123

Start codon: 22372835
Stop codon: 22373894
Alternative polyA sites: Mapped to the searched transcript (containing the 5' and 3' flanking region of 1kb).
22392153, 22392336, 22392453, 22392981, 22393099, 22393240, 22393455, 22394915, 22395564, 22397061, 22397438, 22587185, 22587282, 22604862, 22605376, 22779890, 22779947, 22781734, 22885933, 22886053, 22888748, 22965536, 22971859, 22973139, 22973533, 22973643, 22973749, 22973939, 22974191, 22974276, 22974334, 22980726, 22981989, 22982267, 22991805, 22992092, 22997201, 22997429, 23002012, 23013492, 23013614, 23019732, 23062133, 23133333, 23143201, 23502829, 23518992, 23525382, 23525407, 23525542, 23528310, 23529045, 23803199, 23820638, 23820924, 23821275, 23821801, 23822439, 23822571, 23823122, 23922571, 23922764, 23933219, 23935246, 23936268, 23990983, 24129092, 24130814, 24131056, 24234533, 24288637, 24333755, 24541868, 24541963, 24543030, 24543115, 24759619, 24786975, 24833416, 24857788, 24858030, 25056402, 25059485, 25059547, 25059701, 25059741, 25059813, 25430989, 25431351, 25432717, 25432945, 25524215, 25527227, 25537431, 25554135, 25554491, 25554602, 25554640, 25554707, 25554753, 25554837, 25554900, 25555067, 25555522, 25555589, 25555622, 25556036, 25556591, 25557263, 25557478, 25558440, 25558592, 25558750, 25559179, 25627909, 25638318, 25638421, 25638575, 25638772, 25639359, 25640135, 25644637, 25671768, 25671841, 25730376, 25730812, 25730948, 25735645, 25736076, 25736741, 25736949, 25763948, 25764029, 25764202, 25764693, 25764860, 25765027, 25765327, 25766978, 25776205, 25776355, 25777914, 25778363, 25796110, 25796237, 25796304, 25796440, 25796564, 25796888, 25797002, 25797286, 25797532, 25797627, 25797749, 25797883, 25798232, 25798373, 25798412, 25798832, 25857624, 25958938, 26002291, 26045191, 26048671, 26048767, 26048806, 26048899, 26074684, 26075213, 26103698, 26103934, 26114651, 26114711, 26114762, 26115049, 26115785, 26115846, 26131955, 26140926, 26140972, 26141042, 26141423, 26141580, 26141730, 26141851, 26141939, 26143414, 26143576, 26143732, 26154917, 26155125, 26155187, 26155268, 26158679, 26162254, 26164076, 26167541, 26187823, 26187917, 26200936, 26202306, 26202394, 26202607, 26202750, 26202886, 26203874, 26212501, 26212783, 26212885, 26213006, 26213728, 26216411, 26219010, 26219087, 26219495, 26219646, 26219810, 26230388, 26230448, 26230500, 26230758, 26230802, 26233379, 26233532, 26348242, 26448647, 26764135, 26885874, 26886040, 26888448, 26923640, 26932000, 26934570, 26934737, 26934869, 26935180, 26936333, 26962906, 26963272, 26972438, 26972612, 26973027, 26980697, 26981107, 26981208, 26981332, 26981428, 26981618, 27027700, 27115424, 27124936, 27137622, 27137971
polyA signals: AATAAA, AATAAA, ACTAAA, AATAGA, none, none, AATAAA, AATAAA, none, AATAAA, CATAAA, none, none, ATTAAA, AATAAA, AATAAA, AATAAA, AATAAA, AATAAA, AATAAA, ATTAAA, AATAAA, ATTAAA, AATAAA, AATGAA, ACTAAA, ATTAAA, ATTAAA, AATAAA, AATAAA, ATTAAA, none, AGTAAA, AATAAA, TATAAA, multi, none, AATAAA, AATAAA, AATAAA, ATTAAA, AAGAAA, multi, AATAAA, AATAAA, AATAAA, none, none, none, AATAAA, AATACA, AATAAA, AATAAA, none, TATAAA, AATAAA, none, none, AATAAA, TATAAA, AATGAA, AATAAA, AATAAA, ATTAAA, AATAAA, AATAAA, none, AATAAA, ATTAAA, AATAAA, AATAAA, AATAAA, CATAAA, multi, TATAAA, ATTAAA, AATAAA, AATAAA, none, AATAAA, AATAAA, AATAAA, ATTAAA, none, AATAAA, AATGAA, none, AATAAA, ATTAAA, AATAAA, none, ATTAAA, AATAAA, AATAAA, none, AGTAAA, none, none, none, none, none, multi, AGTAAA, ACTAAA, none, none, GATAAA, GATAAA, TATAAA, none, multi, AATAAA, none, none, ATTAAA, AATAAA, none, AATAAA, none, AATAAA, AATAAA, AATAAA, none, multi, AATAAA, AATATA, GATAAA, AATACA, GATAAA, none, ATTAAA, none, ACTAAA, ATTAAA, AATAAA, none, TATAAA, AATACA, AATAAA, none, none, none, none, AGTAAA, AATGAA, AATAAA, AATGAA, AATATA, AATAAA, ATTAAA, TATAAA, none, ACTAAA, ATTAAA, AGTAAA, AATAAA, AATAAA, AGTAAA, AATAAA, AATAAA, AATAAA, AATAAA, AATAAA, ATTAAA, none, none, AATAAA, AATAAA, AATAAA, AATAGA, AATAAA, multi, multi, ATTAAA, AATAAA, none, AATAAA, none, ATTAAA, AATAGA, ATTAAA, AATACA, none, AGTAAA, multi, AGTAAA, TATAAA, CATAAA, AATATA, ATTAAA, AATACA, none, multi, AATAAA, AATAAA, TATAAA, none, AATAAA, AATAAA, none, none, GATAAA, AATAAA, multi, multi, AATAAA, none, ATTAAA, AATACA, multi, AATAAA, AATAAA, none, none, none, multi, ATTAAA, AATAAA, AATAAA, AATATA, AATACA, AATAAA, AATAAA, AATAAA, AATAAA, multi, TATAAA, AATAAA, AATAAA, TATAAA, none, none, ATTAAA, AAGAAA, none, multi, AATAAA, ATTAAA, AATAAA, TATAAA, multi, CATAAA, AATAAA, multi, ATTAAA, AATAAA, AGTAAA, AATAAA, ATTAAA, none, none, TATAAA, AATAAA

Notes:
mRNA/CDS:
  mRNA/CDS sequence ( exon splicing-sites gapped by the sympol ' / ' )     
>ENSDART00000130911 1324bp 
GTTGTCTGCTTACAGGAAATTGAAATAAAATCACAATGGATTTACTAGACTTAACATATGATTACGAAGACTATGGAAATGTCACCGACTATGGAAATTTCACCTTTGGCAATGTAACACATGAAGAAACTTATTACCACCACACAGCCCAAAACATGTGCTTCACTCAGGTCCTCTGCGTGCTGTTGCTGGTGATCAACATGCTCATCTGTCTGCTGGGTCTTAGTGGAAACGGCGTGGTCATCTGGATCGCAGGGTTTGCCATGAAGAAGTCAGTCAACACCACCTGGTACCTGAGTCTGGCTGTGTCTGACTTCATATTTTGCGCCTTTTTGCCTTTTAACATTGCCTACAGTGCCACATCCAACTGGATCTTCGGCCTCTTCATGTGCAAGTTCACTTCGTTCGTCATGTTCCTCAACATGTTCAGCAGCATCTTCATCCTGGTCATCATCAGCGTGGACCGTTGCGTCGCCGTCATGTTCCCCGTTTGGGCACAAAATCACCGCACCATTGGAAAAGCATCGGTGTTGATCATACTTGCCTGGATCGCCTCCGCAGCTTTAAGCATCCCATCAATTGTGTACCGTGACGTCCAGAATTATCTGGGCACAAACGATTGCATGAACAACTACACGTCCAGCAGGTACGGCCATAAAGTCATTGCTGTGAGCCGCTTTATTTTTGGCTTTATAATTCCATTCATCCTCATCATCCTTTGCTACACGGTCATTATCGTCAGGCTGAGAGCTTCCAAAATGGCCAAATCCAACAAGCCATTTAAGATCATGACAGCTCTCATCCTGACCTTCTTCCTTTGCTGGTTGCCGTACCATACATTTGTGCTGATCGAATTTAACCAGACCTTTGAGAATGGCATCATTCGTCTTGGGATGCAAATAGGCACCATCACTGCTGCCGCAAACAGCTTCCTGAACCCTGTGTTGTACGTGTTCATGGGCAATGACTTCAGAAAGAGGTTCAAGAGTTCCATCTTATCCAAGATTGAGAATGCTATTGGAGAAGAAGGACGAACCATCAGTCGCTATCTGTCCCGCTCCAGCTCGGTGGACGCCAGGGCTTCCACTCATATCTGAAAAACAGACTCAAAGCTGAGTGACTGTTTTGTATGGATGTTAGTTTAATGCACTGACAAAGTTTGATTTGTTGTACAATTAAATTGTGCATGAACATTCTACGTTTTAAGACAAAAATATGATATATAGGACTATAAGAAATGTACTGCCTCAGTGCTGCTTAGTGGATGCCTGGGAAAAGAAAGTAGAACTTGGTTATTTTACAATTAATCATCCACTAATACACC
Protein product:
  Amino acids sequence (deduced by the coding sequence)  
>ENSDART00000130911 cmklr1-201 430aa
MDLLDLTYDYEDYGNVTDYGNFTFGNVTHEETYYHHTAQNMCFTQVLCVLLLVINMLICLLGLSGNGVVIWIAGFAMKKSVNTTWYLSLAVSDFIFCAFLPFNIAYSATSNWIFGLFMCKFTSFVMFLNMFSSIFILVIISVDRCVAVMFPVWAQNHRTIGKASVLIILAWIASAALSIPSIVYRDVQNYLGTNDCMNNYTSSRYGHKVIAVSRFIFGFIIPFILIILCYTVIIVRLRASKMAKSNKPFKIMTALILTFFLCWLPYHTFVLIEFNQTFENGIIRLGMQIGTITAAANSFLNPVLYVFMGNDFRKRFKSSILSKIENAIGEEGRTISRYLSRSSSVDARASTHI*KTDSKLSDCFVWMLV*CTDKV*FVVQLNCA*TFYVLRQKYDI*DYKKCTASVLLSGCLGKESRTWLFYN*SSTNT?
Citation:
(Leiming You, et al. Nucleic Acids Res. 2015, 43: D59-D67) APASdb: a database describing alternative poly(A) sites and selection of heterogeneous cleavage sites downstream of poly(A) signals.

 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.