Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
  
 Searching for Transcripts 
[Help]  
 
Zebrafish
Danio rerio
 Database: for
 Tips for searching: search using a ID, gene name, symbols or description variable in publications and databases.
 Searching examples: ssr4, ssr, TLR, caspase, also Bb_073760F are available for query.
 

 1. Transcript Detail [Help]   
 Transcript Mapping
 Exons Structure     

Gene id: ENSDARG00000037116 
Gene name: cxcl12a
Chromosome: chr13(+)
Gene locus: chr13(+):31027969-31043317
Gene description: chemokine (C-X-C motif) ligand 12a (stromal cell-derived factor 1) [Source:ZFIN;Acc:ZDB-GENE-030318-1 ]

Transcript id: ENSDART00000053946 
Transcript name: cxcl12a-001
Transcript locus: chr13(+):31027969-31043317

Start codon: 31028066
Stop codon: 31040671
Alternative polyA sites: Mapped to the searched transcript (containing the 5' and 3' flanking region of 1kb).
31040950, 31041075, 31041303, 31042052, 31042222, 31042612, 31043309, 31043625
polyA signals: AGTAAA, AATAAA, none, ATTAAA, AATACA, AATAAA, AATAAA, AATAAA

Notes:
mRNA/CDS:
  mRNA/CDS sequence ( exon splicing-sites gapped by the sympol ' / ' )     
>ENSDART00000053946 3041bp 
GGAGCCTGTTCGCAAATTTAACTCCGAGGCGCAGTTGCTGCTGTCACAGTTGCTCCTGGATTCTACACAGTGCGGATCTCTTCTTCACACTGCAAACATGGATCTCAAAGTGATCGTAGTAGTCGCTCTGATGGCGGTCGCCATTCATGCACCGATTTCCAACG/CCAAGCCCATCAGCCTGGTAGAGAGATGCTGGTGCCGTTCCACAGTCAACACAGTCCCACAGAGAAGCATTCGCGAGCTCAAGTTCCTCCACACACCCAACTGCCCCTTCCAAGTCAT/TGCCAAACTGAAGAACAACAAGGAGGTGTGCATTAACCCAGAGACCAAATGGCTTCAGCAGTACCTGAAGAACGCCATCAACAA/AATGAAAAAAGCCCAACAGCAGCAGGTCTAAGATGTCTGCCAGATGACAAGGAAATCTGACAGCCCACCGTCACAGATATGTACCATATAGTCCTCTGGCATGCTTGCTGACCCAGCACTTAACCTGCCAAATATGCGTCCCAGTAAATGAAAAGACCACCAGACCACCATCGCCACCCATGTAGTCTTCTCTGTTAGCGCCAAGTGCAATTATATATGTATGACTGTGTTGTTTTTTATTTTTTACGTATGATATGTATATACAATGTTTTTTTATATCGTCTCAAAATCAGTAAAGAGATATTTTTGGAGTCCTGTTTGCTCCGTGTTTGTCGTGTTATCTTGGGTTAGGCAGAAAAACATTGGGACAAAGAGGTGTTTTGGAGCAAACGTTCAAAACTCTGAAATATGCACTCTTAAAAATAAAGGTGCTTTATCAGCATTGACGGTTCTACGAAGATACATAGAACATTTTCATTCACCAAATGTTTGTTTCCATTATTAACATGTCCTTAAGACAATGGAAAAATAATTAGGGGACCAAACAAGAGAAGTCATTCCCTTTCGGATTTCCATGGCACCTTTATTTTTAGGAGTGTACTCTAATTTTAGAAGGATTATATGAAGTTCTGAAAACTCATATGCATGCAAGTGCTTTGACACAAAAAGAAGGGCATTGATTTTATCTTTCATTATGTATTTTACTAGTTCATAATTTAGATATTTGTAACAGCATGTTAAAGTTATACAACATATATAGAGAAACAAAAAAAAAAAGAGTCACTTGTTTTTTGTGTTTTTGGAAAGGCAGGGTTACTTTGCCAAACAAACATGAACTATTTAGACCTCACATAAACCCTAATGTATTTCGAATGACTTTGGGGAATGCAATTGGCTTCACTTGAAGGGTCGATTGAGAGTTTTGCAATGCTTTGTAGGCATTAAATCATCTGTTTTGTTAATTGACCGATCAGAGCGTGTGTAAAGAACTCAGCGTCACAACACACTGTTGCTTCACGCTCAGCAGAATCAGGTCATAAACAGAGACTGTCGAGCCTCAAAAGAACTCAATTAACAAAGAAAAAAAGAACAAGTCGAATATAGAGAACTCTGAACGAGCGAATTAATTTACTCAATCATGAAAACTGAATCTAAAGCATTGTAGGTATGATAACCTTTAAAAAAATCAGTGTTAGATAAACATCCAAGGTAGATTTTGACACAAACTAATTGACGTAATGACTACCTATATATACCAGCGCACTTTATAACCCCTTGAGACATTTACTAAAGATCAAATTCTGAATGACGTCCACCATCTAGTGAATAGTTCTAGTGCTTATTGCTTTCTGTGTTTAGAAGTAGTTATGAACTGTATTGCCAAATTTATTAAACATTTGTATTTTCAGCATCAGCTTTTATTATGAGTGGGTTTGTTTTCAGAAATTTGTCAGCTGTTTATGAACAGTCAGATAAACAGATCGTAACAGTAATAGCTGAATATTTAGTGTGTAAAACATCCCAGTTTGTAACGATAAATACATTTAGTTTCCAAAAAGATCTGCCTTTTGAAACACACTCCAAAAAAACATGCTTAAAATGATTTTTAGGTCACACTTTATTTTGTTGGTCCGTTAAATTTAGGTTACATTACATCTACATGTCAACTAATTCTCATTTGATTATAATAGACTGTTAGTTACTGTTACTATTACTGTTGGTTAGGGTTGGGGTTAGGGTTAGTGTAACACATGACACATGACATGTAATTGCAAAGTTTCTTATAGTGAGTAAGATGTCTGTTAAAGAAGCAGTATCAACAGCTATAAAGCAGGCGGTCTACTAATACTCAAATGGACCATCAAAATAAAGTGTTACCGATTTTTATTTTTAATTTACAATTTTTATTTCTAAGCTGAAACAACCAAGTTTAGAGGTTCCAAAATTATTAATAAAAAAATACATCACACCAAAAATCACATCATCCATAGCGAAAAATGCAGCTACAATTTTAATTCCTGGACAAAACAGAAGTGTAATGTGAACAACCACACAAATAGCAGGGCAAACCAATGCCTTGTACCTCTCCAAAGAAAATTAACGTATGGAATTTGCTAGTTACTGCTGGCAGATTCATAATGTGAGCCGTTAAAAGTACCAGGCCTCATTTACAAACACAGCCTTCGGGCACAAAATCTATAAGGAAACATAATGCTGACTCTCGACCTCCACAGGGGTCTGTGTACTGGATGATGGGATAAACCCTCCTGCCAGTTCACTATGGGTTCATAAATGGAAAATTCTGAAAAAAAAATCTTGCAAAAAACTCATGCACTTCTGCGGTTTACCAGTTAAAGCCAAATAAAATAAAATAAAATAAAATAAAATAAAATAAATAAAAAAATATCTCTCAAAATGTCCTAATATGGTGATGCCATTAAAGAAAGGATTTCCAGAATTAAACAAAAGCTGTTTCATAGACATTCCATCATGTTTTCAGCACTGACAAGTAACTTCTACTGCCTTCCACTCATGTTTCCCACTTAATGTGAATATTACTTCTATGTATATGGCAGCTTATGGCAGCACATCTGTTGTTCTTTCTTTTGTGAGTTTGTACATTGGTTTGATTTAGTCCGTAAAAGTGTTTATTTTGAATAAATCATTATGAAAAA
Protein product:
  Amino acids sequence (deduced by the coding sequence)  
> cxcl12a-001(ENSDART00000053946) 100aa
MDLKVIVVVALMAVAIHAPISNAKPISLVERCWCRSTVNTVPQRSIRELKFLHTPNCPFQVIAKLKNNKEVCINPETKWLQQYLKNAINKMKKAQQQQV*
 
Citation:
(Leiming You, et al. Nucleic Acids Res. 2015, 43: D59-D67) APASdb: a database describing alternative poly(A) sites and selection of heterogeneous cleavage sites downstream of poly(A) signals.

 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.