Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
  
 Searching for Transcripts 
[Help]  
 
Lancelet
Branchiostoma belcheri
 Database: for
 Tips for searching: search using a ID, gene name, symbols or description variable in publications and databases.
 Searching examples: ssr4, ssr, hox, TLR, caspase, also Bb_073760F are available for query.
 

 1. Transcript Detail Expression Pattern Orthologs among Species [Help]   
 Transcript Mapping
 Exons Structure     

Gene id: Bb_291070F 
Gene name: CASP8
Chromosome: Sc0000888(+)
Gene locus: Sc0000888(+):44170-48889
Gene description: Caspase-8

Transcript id: Bb_291070F 
Transcript name: CASP8
Transcript locus: Sc0000888(+):44170-48889

Start codon: 44170
Stop codon: 48887
Alternative polyA sites: Mapped to the searched transcript (containing the 5' and 3' flanking region of 1kb).
44191, 49862
polyA signals: ATTAAA, AATAAA

Notes:
  GO annotation matched    
 GO Id Ontology Term
 QuickGO:0042981  Biological Process  regulation of apoptosis 
 QuickGO:0005515  Molecular Function  protein binding 
  InterPro protein Families and Domains annotation matched 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR001875  13-94  3.5E-21  Death effector domain
  KEGG annotation matched  
 KEGG Id Definition
 KO:K04398   caspase 
mRNA/CDS:
  mRNA/CDS sequence ( exon splicing-sites gapped by the sympol ' / ' )     
>Bb_291070F 1296bp 
ATGAGTGGCTCGGAGAGTGGCGAAACTGTCAGTCCGTTTCGCGTCCTGCTACTTCGCCTTTCCGAGCAGATATCTTCCCAGGAGCTGAGCGACATGAAGCACCTGCTGAAGGACGATATCGGCCAGAGAAGGCGCGAGGAGGCGCTGTCGTGCCTGGACCTCTGGGACCATCTGGAGAAAGCCGGAAAGCTGTCGGACGGACGGACGGACCTGCTGAAGGACGTACTGTACAATCTGCCCAGGAGGGACCTGGTCAAACTGGTGGAGGAATATGAAAATCAGAGGAAAG/AGTCTCAAATTGCTGTGTCTACATGTGGCAAGACCACCCCACCCCCCATCCAGTGCAAGGCCAACCCATCCCCCACCCAGTGCCAGTCCAGCCTACCCCCCACCCAGTGTATCAGGCAGACAAGTGAATCTGCCAAACCTGTATGTTTTGCTTACACACAGCCTCCCTTACAGGAGGAAG/GTAAGTCCTCCCACCTGCCCACCAGTGTTCAGTCAGAATCACAGACACTCTACAATGGCTTACCCATTACAG/GGGACAACATGGCCCGGCATTCCCCAAGAGATTACAGACAAAAAGCTGTGAGAATTAAGGAGCAGAAAGTCCTGCCTAAAGCACAGAACTACATGGAGACGGCCGGGTACAGGGTGGCGATTGTGGGCGGGAAGCACTACGAGATAGATGAGGAGGAGTTTGTAGAGATGGACCACAGTTCATCCTACCACATCCGGCTGACCAACTCCCACCTCCGCTCATGTGATGCACAGCTGTCCATCGATGGCAAGGACGTGGGGACATGGCGTCTGGAACCCAAACAGGAGATTGAGTTGGAACGGCCTGAGGAGGAGCAGATGTGTTTCACCTTCTTCAGCACCAGGATGGCTCCAACAGAGGCTGGCATCAGGAGGGGGGTAGAGGAGAATGGTTTGGTCCAGGTCACTTTCACGCCAGAGAAGATGAGAGAAGAGAAGACCACAGTTAAAG/ACCTGTATCGTGGAGGTGACCAGGGAGCTGAGGACGACACAGCCAGCAGTGACTCCTCTAGTGGGGAGGAAGATGAGCCATTCCGCAGTGACACGCCTCTGAACTGGTCGTCAGGGGCAACAGCTCTGCAGGGGATCAGCCAGCAGGAGTTTGAGCAAGTAGAGGGAGAGATTGAGAAGGATGAGGAGGCCCAAGTTATCATGATCTTACGTCTGGTAGCGAG/AATTGATGGTTCTAAGGTAGAGGTCTCCAGTGCTCCAATCAAACCGCTGACATCGAAGCGTCCAAGAGCAATCCAAGACTAG
Protein product:
  Amino acids sequence (deduced by the coding sequence)  
>Bb_291070F CASP8 432aa
MSGSESGETVSPFRVLLLRLSEQISSQELSDMKHLLKDDIGQRRREEALSCLDLWDHLEKAGKLSDGRTDLLKDVLYNLPRRDLVKLVEEYENQRKESQIAVSTCGKTTPPPIQCKANPSPTQCQSSLPPTQCIRQTSESAKPVCFAYTQPPLQEEGKSSHLPTSVQSESQTLYNGLPITGDNMARHSPRDYRQKAVRIKEQKVLPKAQNYMETAGYRVAIVGGKHYEIDEEEFVEMDHSSSYHIRLTNSHLRSCDAQLSIDGKDVGTWRLEPKQEIELERPEEEQMCFTFFSTRMAPTEAGIRRGVEENGLVQVTFTPEKMREEKTTVKDLYRGGDQGAEDDTASSDSSSGEEDEPFRSDTPLNWSSGATALQGISQQEFEQVEGEIEKDEEAQVIMILRLVARIDGSKVEVSSAPIKPLTSKRPRAIQD*
Bb_291070F CASP8 ,Caspase-8.
 
 
 
Citation:
(Leiming You, et al. Nucleic Acids Res. 2015, 43: D59-D67) APASdb: a database describing alternative poly(A) sites and selection of heterogeneous cleavage sites downstream of poly(A) signals.

 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.