Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
  
 Searching for Transcripts 
[Help]  
 
Lancelet
Branchiostoma belcheri
 Database: for
 Tips for searching: search using a ID, gene name, symbols or description variable in publications and databases.
 Searching examples: ssr4, ssr, hox, TLR, caspase, also Bb_073760F are available for query.
 

 1. Transcript Detail Expression Pattern Orthologs among Species [Help]   
 Transcript Mapping
 Exons Structure     

Gene id: Bb_283530R 
Gene name: TLR2
Chromosome: Sc0000764(-)
Gene locus: Sc0000764(-):579-2311
Gene description:

Transcript id: Bb_283530R 
Transcript name: TLR2
Transcript locus: Sc0000764(-):579-2311

Start codon: 2309
Stop codon: 579
Alternative polyA sites: Mapped to the searched transcript (containing the 5' and 3' flanking region of 1kb).
polyA signals:

Notes:
  GO annotation matched    
 GO Id Ontology Term
 QuickGO:0031224  Cellular Component  intrinsic to membrane 
 QuickGO:0007165  Biological Process  signal transduction 
 QuickGO:0004888  Molecular Function  transmembrane receptor activity 
  InterPro protein Families and Domains annotation matched 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR000157  299-396  1.4E-18  Toll/interleukin-1 receptor homology (TIR) domain
  KEGG annotation matched  
 KEGG Id Definition
mRNA/CDS:
  mRNA/CDS sequence ( exon splicing-sites gapped by the sympol ' / ' )     
>Bb_283530R 1308bp 
ATGTTCGACAAATCGATAGACATAATGCCCGAGAAGACAACCAATTGGTTTGCATATTTCAATAGGTCCTTGGTCAACTTGAACGAGTACGATCTACAGGCACGTCGGTGGCGCAGGCGGGTAGGGTTAGATAACCTTACCCGCCTATCGCCTCCCGATAAACAGTTACTGAAGCGAGCCAAGCAAGATGCCATCGCATCCTGTGAAGGGGCAACAACACCATTCAGCACTTACTTCCTGGGGAAAATCTGTCACAGACTTGCAATTCATCCTGTAGCAAATGAAGTGGAGGACAAGGATGAATTAGAGAATGCAGTGGGCCACTTTGACCAAGCGCTGCAGTTAGAGGATGGATATACTGACTGCAAGATACATTCAGCCAAAGCCTGGAGCCTTGAAGTTGCAGGAGAGCACGAAAAGGCGGCAGAGTCTTATAAGCGTGCGGTTGAGAACGACGAACCTACCTTCCACCGTAATATTCAAGGCCTACTAACTAGTCTACTGACACTCCATGGTTCAACACACCGTCACAGAGAGTATTACACTGCCGAACTTGCCTTCTGGATCAACGAAGGCTACAGAAAGTACGAAGACACCAAACAGTTCATTCGCTATTGCGTCGCCAGGTTTGGAAATCAGATGATAGAGGTATGTCGATATCTTATTGACCATGGGAATGTCCGGGTGGCCAGAATGTGCCTCGAATGTTTCAAACAGCGAGAGGGCATTGACAACTACAAAGCAGCAGCGTCGATGATGTCAGACATTCCTGAAGATGAGGAAAATGGAGCATCTAATGCTGTAGGCAAGACTTCAGCAAGGCAGCCTGTGCAAGAAAATCGCGTAAACATCCCAGTAAGACAGGGAAAATCGCGCAACATTCAAGGGTTCCAGTACGACTTCTTTGTGCTTCACGGTAGAACAGACGCCAGCTGGGTGAACCATGTACTTGTACCAGCGTTGGAGGTGGAGTGGAGTTTTAAAG/CTTGCGTAGCTGACCGAGACTTCGTGCCCGGGAAGAGCGTATTCAAAAACATCATCTACAGCATCGAGAACAGCTACAAGACCCTGTTGATCCTCACGCCAAACTTCGTGACCAGTGAGTGGTGTAAGTACGAGACAGAACAGGCCTTGGTAGAAAGTCTCACGTCCAAGACCGGGCGCGTTATTCCCATCATGCTCCAGGAATGTGACGTACCGGCTTCATTGCGTACAATCACGTATCTGGATGTGTCACGTGATGCTATTGGCCCTCGCGATTGGTTGAAGCTGAAGAAATCTTTGGAGGATGCGACTCCAACAGAGTAA
Protein product:
  Amino acids sequence (deduced by the coding sequence)  
>Bb_283530R TLR2 436aa
MFDKSIDIMPEKTTNWFAYFNRSLVNLNEYDLQARRWRRRVGLDNLTRLSPPDKQLLKRAKQDAIASCEGATTPFSTYFLGKICHRLAIHPVANEVEDKDELENAVGHFDQALQLEDGYTDCKIHSAKAWSLEVAGEHEKAAESYKRAVENDEPTFHRNIQGLLTSLLTLHGSTHRHREYYTAELAFWINEGYRKYEDTKQFIRYCVARFGNQMIEVCRYLIDHGNVRVARMCLECFKQREGIDNYKAAASMMSDIPEDEENGASNAVGKTSARQPVQENRVNIPVRQGKSRNIQGFQYDFFVLHGRTDASWVNHVLVPALEVEWSFKACVADRDFVPGKSVFKNIIYSIENSYKTLLILTPNFVTSEWCKYETEQALVESLTSKTGRVIPIMLQECDVPASLRTITYLDVSRDAIGPRDWLKLKKSLEDATPTE*
Bb_283530R TLR2 ,.
 
 
 
Citation:
(Leiming You, et al. Nucleic Acids Res. 2015, 43: D59-D67) APASdb: a database describing alternative poly(A) sites and selection of heterogeneous cleavage sites downstream of poly(A) signals.

 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.