Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
  
 Searching for Transcripts 
[Help]  
 
Lancelet
Branchiostoma belcheri
 Database: for
 Tips for searching: search using a ID, gene name, symbols or description variable in publications and databases.
 Searching examples: ssr4, ssr, hox, TLR, caspase, also Bb_073760F are available for query.
 

 1. Transcript Detail Expression Pattern Orthologs among Species [Help]   
 Transcript Mapping
 Exons Structure     

Gene id: Bb_088060F 
Gene name: CAD
Chromosome: Sc0000042(+)
Gene locus: Sc0000042(+):1170052-1174431
Gene description: Caspase-activated DNase

Transcript id: Bb_088060F 
Transcript name: CAD
Transcript locus: Sc0000042(+):1170052-1174431

Start codon: 1170052
Stop codon: 1174429
Alternative polyA sites: Mapped to the searched transcript (containing the 5' and 3' flanking region of 1kb).
1172703
polyA signals: none

Notes:
  GO annotation matched    
 GO Id Ontology Term
 QuickGO:0005622  Cellular Component  intracellular 
 QuickGO:0006915  Biological Process  apoptosis 
 QuickGO:0005634  Cellular Component  nucleus 
 QuickGO:0005737  Cellular Component  cytoplasm 
 QuickGO:0006309  Biological Process  DNA fragmentation involved in apoptotic nuclear change 
 QuickGO:0016787  Molecular Function  hydrolase activity 
  InterPro protein Families and Domains annotation matched 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR003508  4-78  2.1E-25  CIDE-N domain
  IPR015311  105-328  2.7E-88  Apoptosis, DNA fragmentation factor 40kDa
  KEGG annotation matched  
 KEGG Id Definition
 KO:K02311   DNA fragmentation factor, 40 kD, beta subunit 
mRNA/CDS:
  mRNA/CDS sequence ( exon splicing-sites gapped by the sympol ' / ' )     
>Bb_088060F 996bp 
ATGGGCTCCAAGCCGTTCAAGATACGTGCAGCGAATGATACCCAGAAGTACGGAGTGGCGGCACAGGATCTCAACGATCTGATTGCAAAGGGATGCAAGGTTCTAAAG/GTCCCTATCAAGGGCTGCAAAATCTGCCTGCAGCAGGATGGAACTCTCATCAACAGCAGGGAATTCTTCCAAGCACTCCCGCCGCTCTCCGTCTTAGTCTTCCTCAGAAAAGGAGAGAAGTGGACTGGAGATGACT/TTGGGAAGATGATCCTGTCTCTGTTGGAAGCCCCTGAAGATCCTGTAAGGAAACAGCAGTTAACGGAGAGTCTTGAAGGCATGATTGCCAAGGAGTCGTCCCCAGAGAGGGTCCATGCCCTGAACTTGTACCTGCAGAGTCTTCCAGACAACATCGATGCAGAAACCAGGGAGGAGGACCCAGACTGGTTTGAAG/GTTTAGAGAAGAGATATAAAACCAAAAGTCAAGTGATGGCCTGTAGTGCACAGGGGAGGATAAGAGGCTACTATTCAAAG/ACAAAAGAATATGTCTCCAACCTGGAGGATCCTGTAGCCAAAATAATTCTGAAGAGAGTGCTAGAAAACTTCCGGCCGTGTCTGAAGAACAACGGCTACCACGGTGACTACTTCAGACGAACGGCAAAGCCCAAGAAGCGGCTGTGCACGCAGGCGGGCTGGTTCGTCTGCCACGGTCCGTACAACACGAAGACATGTCAGGACAAACACATGATCAACCCGTACAGCAGCCGACAGAAGAGGGCAGTGTTCAGCACTTGGAACCTGGATCACAG/AGTTGAGAAGAGTCGAACCATCCTTCCCAGCATGCAGCAGGCTGCTGTTTCCTGTCCGAAGGGGAAACAGCTGAACTGGGAGTACTTCTACGAACTCTTGTTCACCACAGACAACCTCAAACTGGTGGAGATCAGCTGTCACAAGAAGGAAGCACACAAGGGGTATGAATGTGACGAGAAAAAGTACTACACTAGTAAATAG
Protein product:
  Amino acids sequence (deduced by the coding sequence)  
>Bb_088060F CAD 332aa
MGSKPFKIRAANDTQKYGVAAQDLNDLIAKGCKVLKVPIKGCKICLQQDGTLINSREFFQALPPLSVLVFLRKGEKWTGDDFGKMILSLLEAPEDPVRKQQLTESLEGMIAKESSPERVHALNLYLQSLPDNIDAETREEDPDWFEGLEKRYKTKSQVMACSAQGRIRGYYSKTKEYVSNLEDPVAKIILKRVLENFRPCLKNNGYHGDYFRRTAKPKKRLCTQAGWFVCHGPYNTKTCQDKHMINPYSSRQKRAVFSTWNLDHRVEKSRTILPSMQQAAVSCPKGKQLNWEYFYELLFTTDNLKLVEISCHKKEAHKGYECDEKKYYTSK*
Bb_088060F CAD ,Caspase-activated DNase.
 
 
 
Citation:
(Leiming You, et al. Nucleic Acids Res. 2015, 43: D59-D67) APASdb: a database describing alternative poly(A) sites and selection of heterogeneous cleavage sites downstream of poly(A) signals.

 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.