Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
  
 Searching for Transcripts 
[Help]  
 
Lancelet
Branchiostoma belcheri
 Database: for
 Tips for searching: search using a ID, gene name, symbols or description variable in publications and databases.
 Searching examples: ssr4, ssr, TLR, caspase, also Bb_073760F are available for query.
 

 1. Transcript Detail Expression Pattern Orthologs among Species [Help]   
 Transcript Mapping
 Exons Structure     

Gene id: Bb_073760F 
Gene name: ssr4
Chromosome: Sc0000031(+)
Gene locus: Sc0000031(+):1764674-1771073
Gene description: signal sequence receptor, delta

Transcript id: Bb_073760F 
Transcript name: ssr4
Transcript locus: Sc0000031(+):1764674-1771073

Start codon: 1764674
Stop codon: 1771071
Alternative polyA sites: Mapped to the searched transcript (containing the 5' and 3' flanking region of 1kb).
1770222, 1771090, 1771411, 1771566
polyA signals: none, AATAAA, none, none

Notes:
  GO annotation matched    
 GO Id Ontology Term
 QuickGO:0005783  Cellular Component  endoplasmic reticulum 
 QuickGO:0016021  Cellular Component  integral to membrane 
  InterPro protein Families and Domains annotation matched 
 InterPro Id Term
 InterPro:IPR008855  Translocon-associated 
  KEGG annotation matched  
 KEGG Id Definition
 KO:K04571   translocon-associated protein subunit delta 
mRNA/CDS:
  mRNA/CDS sequence ( exon splicing-sites gapped by the sympol ' / ' )     
>Bb_073760F 522bp 
ATGGCGTCGTGGACGAAGATGTTTGCACTTTTCTCTCTCGTTTTGCTGTTTTTCTGCAGTTCAAATG/CCCAAACATGTGTGGGCCCCACCGTAGAGGCTACCTCATTCACCTCCGCGGAGGCTAACCTGGCCATGGAGACAACCTTCCTGGTGGAGTTCACCCTCTCCTGCAAGAACGCAGCCAAG/GACCTAGTTCTGCACGCAGACATCGGAGACCGTCAGTTCCCGGTGAGCCGCAGCGCCGACGGGATGCGCTACCAGATCAGCTGGACTGCCGAACACAAGCAGGCGCCCGCCGGCAGCTACGAAGTCAGGTTCTTCGACGATGAAGGATTCGCCGCACTCAGAAAG/GCCCAGAGAAGTGACCAGGATGTGAATGCTGTCAGCTCACTCTTCACCATAACAGTTCATCACAGG/GGCGTGTCCCAGGGTCCTTGGGCCAGCTCGCCGACCGTTGCCGCCGTTGCTGCGTTCGCCGTCTGGCTGTTCGCCTACAGAGCCAAGCGACAGATCCAGGATTGA
Protein product:
  Amino acids sequence (deduced by the coding sequence)  
> ssr4(Bb_073760F) 174aa
MASWTKMFALFSLVLLFFCSSNAQTCVGPTVEATSFTSAEANLAMETTFLVEFTLSCKNAAKDLVLHADIGDRQFPVSRSADGMRYQISWTAEHKQAPAGSYEVRFFDDEGFAALRKAQRSDQDVNAVSSLFTITVHHRGVSQGPWASSPTVAAVAAFAVWLFAYRAKRQIQD*
 
Bb_073760F ssr4 ,signal sequence receptor, delta.
 
 
 
Citation:
(Leiming You, et al. Nucleic Acids Res. 2015, 43: D59-D67) APASdb: a database describing alternative poly(A) sites and selection of heterogeneous cleavage sites downstream of poly(A) signals.

 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.