Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_310300F:1-750 310300F_057040_eq Sc0001460:2410-6649(+) tlr22 toll-like receptor 22

 Link to be detailed in other pages:
 [transcript: Bb_310300F] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR001611  127-175  1.4E-10  Leucine-rich repeat
  IPR001611  348-388  2.5E-7  Leucine-rich repeat
  IPR001611  428-488  2.3E-10  Leucine-rich repeat
  IPR000157  598-739  8.9E-22  Toll/interleukin-1 receptor homology (TIR) domain

MAAFRTTLSILCLISALCCAEFGASLPDGRAKPAVTTKLLTLKNPSGFSSPKAEKKSPYDLDFLRNCIRLRDTVVSCTRRHLRYVPRGIPATTTRLNLTD
NLFQGLGPKTFPQLYKLEILDLSKNLISSIQPGSFRNTCNLTTLKLNHNNISVILKGAFDGLVRLEYLELAFTRLSNLDNVEFLTPNLKSLNFTSFAGNG
VTLCKLGNEFRHLKQLAHFDLAYNDIADLEHDCFAALNDSRVQALDLSFNKIQAIRHPVFWPVRNLAYLFLDGNRLDMKTLNTTFNNLNSIETTSLHLSL
SNSTFLAGVKTPSNTTFARLANLSITQLDLSHVGLQFLPESGLFSFFPRLESLILVGNNITALPPKAFSGLGLVSLKRLYLGRNNLNAMLDQVETSRPFT
NLTSLDVLDLSQNNFESLTALPFENLHNLTRLDLSFNRIPSIPNRLFKYLPKLRTLKLNSNRQLGKLPKAGFGFLQNLDNLNLEDNPLQCTCEEEWFYDW
VVSNRTKTLFYNLSNYGCVAPERLVHKTILDFDPEAQGCHDKTGIRVAISFAVLLVVFLLGVVVGYKNRWYIKYGCFVIKARFHGYQALRDSNTQKKFDA
FVSYNHHDRAWVMDELVPHLEEEEGSEFRLCLDYRDFVGGAPITDNIVNAIYDSRKTICLVTEEFLKSEWCEMEVQMATYRLFDEQVDVLILVFLEDIPD
RALHRYHRLRRLMCKRTYLEWPKDPQGKALFWQRLKDALKTGDRPPIENI


 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.