Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_280950F:1-803 280950F_004940_in Sc0000728:45785-56278(+) LRDD caspase 9, apoptosis-related cysteine protease

 Link to be detailed in other pages:
 [transcript: Bb_280950F] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR001315  7-89  1.5E-9  CARD domain
  IPR000906  354-410  2.2E-9  ZU5 domain
  IPR000906  465-543  2.0E-4  ZU5 domain

MDPAHRDILRRHRGRIVDDLNVDRVKGSLIQNGVFGDGHWDDIATAGRGTRHDKASALMDELPRRGPRAFWCFCESLMTNGYDFLAKPLIEKAKQLSQKV
PTRILALLLREQISRIKQEYQEIVKKRRVPVMRALKKVGQIIKTGGRVSDTRVTSLKHIKEALESHKWKHIKEALESHIDQKDLSRFNESEGSALTDILD
MVEKLKGIRYELQRDGSVPEYAGQINSLLSGDFSDLYEKTINEGNDYMKNWRKQGVNDSDIRHVGSVLVLIPYLCDLSERAVEVMSRRSSHGAEGFPTSQ
ATAGAYMQTPDYEEKYEEPVSPVSEELGQEDEATQLQRLKLSPKERKLQTKSCTVTVPPGAASETTLQVIRPNDVTIPLNDGEMLVSEVIELGPHGTAFR
KPVTVQMQYHDMSSDGAREPVMWITENESQWKCKGELIGSINHSCTIAIAAQLKKDQFSVSSERTRVTSSTHPAVQIIFPEKSVPTPIRVNIQVQDVPRE
TIEAVKVNLRHRRGLISTSPIVNVETDSTVKFDKPVTVRVPHPQHYMGTRHIAIGSPKLRVMSRDEGAEDWVDVTNDVNIRVLGDFVEFAVNHFTSYVVL
EIESSSGDTVELGQIPLEMCKWIHQCDVKFILLQQEDNPNALLIECHKASNADRKFAKLKSQGYRGPAPSETVRVREGQRVEVSLVGNVSFASFCRFSKH
LVFHSKMNPRLNIVAKADQVQGEEGLEGVGFVEFSALPKILVEKTKERRVRALCNYRSSGKRERPKPRLLCHIPIKLPYQRQQTTDRQYGQVHRTGTAQE
IKT


 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.