Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_266770F:1-206 266770F_038940_eq Sc0000563:74957-77209(+) tlr22 toll-like receptor 22

 Link to be detailed in other pages:
 [transcript: Bb_266770F] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR000157  25-97  1.9E-10  Toll/interleukin-1 receptor homology (TIR) domain

MAKDSDSVHQWDVFISCHPNQLPYVLGILTQALEDIGQKVYLYERDSEPGSPIADNIFEAAMASRKTVVCFTEDYLHSEWNLYEAMVAQGVKPSGGRMVP
IQLLSCQIPPKYQLVCPLNCTDRLHRRFFWRKLLGALDIPDSSDIAAQLNVAYPEGRLDMILGKHMPDVIPDPPPPRSECEPPPQNPQDNAELMPVDHQE
QLAHRC


 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.