Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_248570R:1-951 248570R_273670_in Sc0000414:37167-50219(-) TLR3

 Link to be detailed in other pages:
 [transcript: Bb_248570R] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR001611  117-174  5.1E-10  Leucine-rich repeat
  IPR001611  217-265  3.1E-9  Leucine-rich repeat
  IPR001611  267-325  2.2E-13  Leucine-rich repeat
  IPR001611  504-535  1.0E-6  Leucine-rich repeat
  IPR000157  709-856  1.9E-14  Toll/interleukin-1 receptor homology (TIR) domain

MAAGRLALFVATTLAVWSVSQQTPPATGQVSTGARGKSCRVYNRTVADCSSMRLRSVLDAAVSELPPTIKTLYLLSNGITTLPDCAFCHLTQLEFVDLSF
CNITSVSKTAFAKLVHMKTILLIGNNLTTLENGTFEELQNITEVNLADNKLTEIPYGAFPVKNSLRILDLSGNHVNLQDKGTTNWDRFKSLRHILLRLNG
ISSSTGWIFAREDLNVSLRTLDLSYNKISRLDSAAFNGIRSLQRLVLSSNDILTVNTSSFSSLAQTGLETLVLFRNNLTSVTDNTFTSVPLLKRLDLAYN
NISRIEDNAFEGLRHLEVLSLYLNPLWSAPMAALEKLNSSLLELDLRFCSMLNIQADQFRRFGNLLSLNISDNYIGALGSGHRLTGTEFRGLDNLTSLNI
GGGPGYNRMKIIEKSFVFLPKLQKLVMSGLLGFNENFEGSFEYNPDLRLIDMDRMNIRVLNPYLFQDLRKLEELVLSNNNLYLMLNSDSASSSKKFARFF
GDLTNLQTLRLQGNRLESLQKDIFQNLTKLRYLNLGPGLYGDHNNRLSNLQRELFKSLTSLETLRIDGNLLTSVEKSVFEPVSKSLKELYIYRNNFDCTC
ENLRWFREWVNNTRADVIGLAEGRLTCATPRKYANESILSFHPEVDCVSQVEVIASITTCSVFLVVAVATIVCRQFGLHKYVQYVWVLVTRRRKEAYERL
EGEDLEVEYDAYVSHSAEDVRWIQDVLIPNLEQKSPQLKLCIPDRDTMPGPIIDNVQDYIRRSRKTLCLVTQQYLDQEASWLEMQVASYRLFDKDDRRDV
VVMVFLEPIPKNKLTHFQKLRKLLRPGMFLQWPGPDDTAGHPLFWLLLRDALGTSNNPVPRDRPQCCLLGNAQRKLPKIAEAVVGSSRETKSNIGKWRVP
IFGYRRLSSPCRSRSTLTPNSLIWDHYSLLENAGRFVRRRFSIYSQRHCFA


 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.