Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_226440R:1-970 226440R_220610_in Sc0000296:76758-79673(-) tlr22 Putative uncharacterized protein

 Link to be detailed in other pages:
 [transcript: Bb_226440R] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR001611  66-122  9.0E-13  Leucine-rich repeat
  IPR001611  158-200  1.6E-9  Leucine-rich repeat
  IPR001611  394-454  1.4E-15  Leucine-rich repeat
  IPR001611  512-572  5.9E-15  Leucine-rich repeat
  IPR001611  610-668  6.5E-15  Leucine-rich repeat
  IPR000157  802-958  5.6E-19  Toll/interleukin-1 receptor homology (TIR) domain

MGNPNKSHYCIHSFLCLCLFTIWTKGDPGSIKLNPSECEEWTTLNITCTKLGLTKVPTSIPPSTLHLDLHDNSITELQCKDFSALVNLQYLDLRWNKIKH
IENATFAPLKNLRALNVSGNRIHVSLLPQLVDFLPSLEHLELTLNWKWYDPVMLGNTTSFRGLANLISLNLGGNDIVTVQENSFHGLHKLRNLNLRNNLI
SDIDETAFHPLQELTHLDLSNNYLTSKILQLEELWSSVVRLTSLDLSENLLSSARFAAAFRNFSLLHTLDLSRNELTNLTMADFAPLFSTPLRTLQLERN
SISHIDQRLLTSFSELKSLKLQSNPVPFSQLRDKLAGLQIEDLTLGGSPDLDTIRMDTFPLLPCLTKLTVSQRYEWNPPIKSSRLQEGGFTNLPNLTRLN
LEDYSIVSVEPYTFAGLERLERLELGENRLSDFPERVFHGLRSLTHLGLSYNSLTKIKTHYFNGLNSLFWLNLQNNDILFIEGTAFEDLSSLWYLILSSN
HLSTVEGVWGLSNLRHLDLDRNNFTTLTTGSFSRLGNLTHLSLAHNWVRTIQRGAFSGLALLERLNLADNRLTNLTSWAFDGLWALDNLNLEHNVIVAVE
PYTFYGLKQMKTLNLKGHNVATIPDDAFKGLHNLTELDLSHNQIRTFGKKAFDGLDNLGVLQLQQNQISFLDETVFQKVLDHVWKIDLRDNPFFCDCGLL
WFVFKANSQREKVVGWFTNAFTCAAPPREQGKSLQVLPSTCEGVFMPNLWLASLLSSVGIFLFVMTTFCVNYYYWKLRDLWYRLRNRDRVVRIRDGDHRF
VFDAFVAHHHGDRRWVERDLSRNLEHSVSRPNYRLCLHQRDFRAGVPVITNIRMAVDSSRKIVCVITRRFLRSRWCQFEFQLAQHTMFEEGRGIRLILVF
LEDIPRPLVRQYGHLQAVVDRDTYLEWPEDPRERPLFWRRLRAALGQPLEQEPNDNDSEPDQHGFMTLFE


 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.