Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_198510R:1-534 198510R_227920_in Sc0000196:483936-487298(-) TLR15 Toll-like receptor 15

 Link to be detailed in other pages:
 [transcript: Bb_198510R] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR000157  32-136  7.9E-11  Toll/interleukin-1 receptor homology (TIR) domain

MAPGLESQRQADQGARMIDELQEKKLYNATFVYDDKDLPWVKCAAQYLEENYEKSVYYRGRDATPGHPITDNSINSITNTEVIIVAISKAFLNNFWAKKE
EDWALLDSVKTDGCKLLPVLLEDCDIPKELSDLEALNLTSMEKCEEEHLKQLGKGLHKLLANGQICQRARSMLYPDRYLNGPELYHNGTLVGNNTTTTGD
NESIDQESSVMPYDLQCLLTLLNILACKLVAMSINILDFCIRGIPECFMKLKEVTQTFVTTLLEVLPGDTVRKTVQASVRTILMSLKRVPMSMLPAFLQD
IVSTLASGLRFTGDGSFTTFAATWIYNASVFLFVTHLVNSLLWLGRGYDVFLERLLDVVPLLPPLIKGYFCMLHMPEYRETIRAMYGCKTLTLKSMKDTL
VRANVEYREVRICLLVTFAIEFVMLSGILGSMQISSLLFPMTRLTSLLLLTLHFAFLLCAIIFYYHDDTVHSLISKRRFFFPDIMKKEGFDKQEKRLLSM
IDELSKQRKHKPDRKHLMTGGKPTPKKYKRHPKP


 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.