Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_133170F:1-738 133170F_092950_eq Sc0000088:78576-87585(+) Ssrp1 structure specific recognition protein 1

 Link to be detailed in other pages:
 [transcript: Bb_133170F] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR024954  76-285  1.3E-90  SSRP1 domain
  IPR013719  342-429  2.1E-25  Domain of unknown function DUF1747
  IPR009071  554-622  3.2E-22  High mobility group box domain

MSGDTLEFDQIFQENKGAMYDGRLRITKQGIVFKNNKTGKVDNLAGTDLNLTHWFRVARGYELKVGLKSGAVFKYDGFKESDFDKLSDFINKNYKMRLEE
KELSVKGWNWGTAKFKGPLLSFDIDNMSAFEVPLGNVSHCATSKNEVALEFHQNDDADVSLMEMRFYVPPNQDNPDIDPVQAFHDNVMDKADIIQATGDA
ICIFKELQCLTPRGRYDVRIYPTFLHLHGKTFDYKLPYTTVLRLFLLPHKDQRQMFFVVSLDPPIKQGQTRYHFLILQFSKDEDMTLELSLSEEDCADKF
DGKLQKEMSGPVYEIVSRVMKSMVNRKITVPGGFKGNSGTSAVSCSHKAGAGFLYPLERGFIYVHKPPIHLRFDEISCVNFARGVASNRTFDFEIETKSG
TTYTFSSIEKEEYGKLFDFTTNKKLRVKNRGKNLKDSVNYDEDMMGSDDEGQHDAYMERVKAEAAEGISDEDESSDDEEEDADFNPDGSGSDIAEEYDSN
ASISSSDDDEEDEEKKERRKKKLEKAKNKPAKRKRASDGGRKRKKRQKKDPNAPKKAMTAFMIWLNATRSDLRKENPDASIGEIGKIAGEKWREMGPSDK
EEWEQKAKEDKERYKAAMEEYEARKAEEGSSGGEESDQSEKKKSKKSRSSRPKPSPTKSPSKAGSGANYKSKEYISSDSDSDSSNSDSESEEKEKKSKKK
GKKAKKKSEDEEEEPIASTPPESEESASGGEEEEDEDD


 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.