Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_112210R:1-981 112210R_229610_in Sc0000065:1055257-1058205(-) tlr22 toll-like receptor 22

 Link to be detailed in other pages:
 [transcript: Bb_112210R] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR001611  68-101  1.2E-9  Leucine-rich repeat
  IPR026906  132-198  2.0E-4  Leucine rich repeat 5
  IPR001611  377-436  3.2E-17  Leucine-rich repeat
  IPR001611  561-619  7.9E-17  Leucine-rich repeat
  IPR001611  655-666  1.2  Leucine-rich repeat
  IPR000157  833-970  3.7E-19  Toll/interleukin-1 receptor homology (TIR) domain

MESKPAPLAVCFAAVLAFIAQHGRVRGQLPPPVCQTWNSTTVVCKGDPDEPGFLPTPFLPPGIPETVITLDLSRNNITILYNGSFSGLRKLRSLDLSGNP
IQTIEVGAFAGLENLERLELSSEEWPLNYPLQNGLFQDLRNLKYLTVKTYTDTVSQGVFTGLCSLRHLHLSVKNISNLPDHMFDSLTSLKSLEIEELIKS
DAIEEDRNTTMRRVHSGSGFLQRRLLWAPLHNLKTLSLFHLARASDCYYGPVFRNLSKLETVGMISLPTRSPLKVQMFRPLFLTLRHLHITAKVAPGLLR
PLIHLQTLTLQRVSDPGILPELRHTQIRQLTFHSWKFRTITSGNLAGLKDLKRLKTLIFQHSFVYAIQAYAFSGLLRLQRLDLTACFLKTLHNKTFVGLS
SLTHLNLTDNKMSCLPQGVFKGLPSLTYLDLSHNRLASFQAQLPVTMVNLDLSHNNLNDGSFHLSGLKTVHHLNLSHNEIENVNVTWLPRNITVLDLQHN
KVMYCSLCMANFKYLDLSNNEISSFFNDDSPHGQSVLETLRLDFNVIKAIDFLSQGITKYLKKMTLSHNRIYKIKAGQLTGLDQLEHLDLSNNNIKTVRP
SAFRRLSRLRFLDLRDNNIQHITELTFEGLGHLTHLNLEANRIAVIGNAFQRLYRLRHLNLSNNCGLAALNQTTFGPVVFRLETINIADNPFLCDCHLVW
FVEWALYKYDRVKNMHNPYADIGRGYRCFLPGHLRGRRLTDGLTQKQHSKDRQDPAEVSEQMFFDTVCSHGFQPNRLLACVLASSGIFFAMMTIFLVDYH
VGRVQYLLWMLAKWRRPKIGEVEDHEPPRYTHDAFLAYNNRDVWWVIHEAIENLEPDYSLVLHERDFAVGAPIVENIADAVENSRRTVCLITRNFLKSKW
CEYEFQLAQYHMFEKGGGRRLILVFLERIPKQMLKQFRHLNAVVKRDTYLAWPGDVRKRPLFWRRLRDALGDPLPRDPEPQ


 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.