Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_111540F:1-1113 111540F_063080_in Sc0000065:151091-167736(+) casp9 caspase 9, apoptosis-related cysteine protease

 Link to be detailed in other pages:
 [transcript: Bb_111540F] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR001315  7-90  2.2E-10  CARD domain
  IPR000488  540-612  9.9E-12  Death domain
  IPR001315  725-800  9.8E-11  CARD domain

MNPAHEDILRRHRTDIVKVLDVAHVKDSLIERGVFSTQLWDEIEKAGGESKREKASRLLDRLPTRGPNAFSCFCEALMAGEYDFLGEQLTEEAEQQHVLE
SVQARGRRTPSSSHHFFEEVAVNGQAQTMDQSLSGQINNIKKEYRKCLLRGKGVTLVKALNKVIHFKKLRGKRASEQTVTSLKYIKEALKSPSFDESNVS
ALTDFLGLVEKLKHIRDELQKDGSVPDYVTKLNSMLAEGADFSTLYNITLDIGLDYLRDFGMQGMDAASKSKFGSVLVLIPYLCDLSEQAVQLTKRCVAD
RVDSSPSSEAERMEPFSDVVVEGVAMSPYPEQDEVFLPEGQSSARSYVDIEGTMMSRLDRASERIGRLEQTQIRYSQERDRTSNGILEEIKKLNSKMDVQ
ALKIDQMDKKIEQQSILLQQNEDIKASLFDVSNHLEYIKKALGGQTEKKTVLEAKVSSLEGRLLNLLEQEIDRSKLMEEIKGVESEVVELKEWFQDGDLY
ITERLEQMNRHLLDVLLKLERDSLGRQLSTAIDMVEKQLKFKEFTRFARMLGFSDQESTKIRSAARDNFGQQKSELLRKWREKNGSNATAKHLEQACRST
GLSTLADKISRISGAPSAAHAVRLPSLTGGQGNPNRPVVRKTSYQELKAGLCIRAISTFHYLKSQVILLSRLLIFTEGNGILVKDPKDLHCKGATSKHNN
QIELRPYARFTRDTVVVEMDPAHEDILRRNRGRIVKDLNVDKIKDNLIQKEVFDDGQWEDIATAGKGTRHDKASALMAELPRRGPKAFWCFCESLMTGGY
DFLGKPLIEEGATSAAVSQPQLVIRQPGTVLVYSRKDIEGCENVQIGDNNVMGKLIPPEDKFVKTCIKLGINPEQKQDIFERLGNEETREQFSAMMEEKC
NVRCKLKNAGEGCILLELEVPTEADRLQLLRMARDGTFQQVLLEMFLPELAAEGRAVNMNLAIGVRNPSQEMLDELQGAVASSEKIDKRFVQFGKEIRQE
LRQHNEDIKANLFDVSSHHTDIKQALGERDEMSDKVNELEERVRDLLIHEIDQTTIKGELKDIERKVVELKEQFQGGDQKIQDGLTQMNEQLEKMLSTLE
RDSMGGWNSIFFA


 
Jan 11, 2021. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.