Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_073760F:1-172 073760F_061290_eq Sc0000031:1764674-1771073(+) ssr4 signal sequence receptor, delta
 [transcript:Bb_073760F] [APASdb:APA sites] [Gbrowser:Mapping view] 
MASWTKMFALFSLVLLFFCSSNAQTCVGPTVEATSFTSAEANLAMETTFLVEFTLSCKNAAKDLVLHADIGDRQFPVSRSADGMRYQISWTAEHKQAPAG
SYEVRFFDDEGFAALRKAQRSDQDVNAVSSLFTITVHHRGVSQGPWASSPTVAAVAAFAVWLFAYRAKRQIQ


 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.