Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_056090F:1-771 056090F_121280_in Sc0000019:2148571-2156161(+) casp9 caspase 9, apoptosis-related cysteine protease

 Link to be detailed in other pages:
 [transcript: Bb_056090F] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR001315  7-89  4.1E-12  CARD domain
  IPR000157  101-207  5.7E-15  Toll/interleukin-1 receptor homology (TIR) domain

MEERHRALLSAKRLEISSDLRFRDIRRRLLDSGILNGENLDEIEKRQSRGDQVKALLDILPTKGPHAFSVFREALNDSGYPHLARILNDESQQAPPREPR
VFIIHAGEDKESFVRPLVTTLQQQGLAEKDIFFDDVSIKPGEVIRDRIISTLSSKSLELAVVVVSTSFLNKPYWPKLEFETCLKNNKRIFPIWVDANDDS
FKAFSELVGKYSPTLKQMSARRVQRDHVTDELTNIAAEVVQRLSTVGRSTPQPAAIQTLWYLTPLSSRGDSGSSDDETSQGTHAAGVSDEQGIEEKLNEK
KAKQLELEMAQWEKRGKVLGQHLTLLKKAEGLLSKEKIERKTEEMLDCYYQSSFHIVEVKIGYTILHFIPHNLTTLDTFWTDYKSGQLSCNLTDCLITDE
MRTLAGEDLVVGVIMLEEQYRQWTEYFKAEDIEMRRPKMTPTAFLQTIPAPVPQSKAKMADSDSKMKSPEMNIPTVSELRVEVRQLLKKRSEDFNVLVVG
RPGSCKSTLINSMNMALAGKWSELTSFGQGGVQNLTLRLDKVPMFEDQFMTEKVENYDKKLYFWDCAGMENTADEVYGEFIGLTLDGKVEDKTNVFDVLR
KKGGLISIKDLQEKFPKVNEDNRFNRLLFVCACDEMAPENLLELVRETTASHHNKGRNIPVFLVLSKKDKAKDNQRKYNDTKKTAQSLLSLEGNEQRTTE
LTLYHAKIEGKDEGCAIDARKKFLPNEDIDRNLLIFLINLLDAAYDRALAHEPELEPKETPKKRFGLKCKP


 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.