Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_055410R:1-1038 055410R_272000_in Sc0000019:1513529-1518156(-) NLRC3 caspase 9, apoptosis-related cysteine protease

 Link to be detailed in other pages:
 [transcript: Bb_055410R] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR001315  30-110  6.2E-12  CARD domain
  IPR000157  124-229  8.2E-15  Toll/interleukin-1 receptor homology (TIR) domain
  IPR001611  806-828  0.067  Leucine-rich repeat
  IPR001611  834-856  0.0079  Leucine-rich repeat
  IPR001611  864-879  0.33  Leucine-rich repeat
  IPR001611  892-911  0.011  Leucine-rich repeat

MHVCDQQRKFELTPCTISKVEYQMEERHKALLRAKRLEIASDLRFRDIRRRLLNSGILDGENLDDIENEQSRGDQVNALLDILPTKGPNAFSVFRDALND
SGYPHLARILNAESQQAPTREPRVFIIHAGEDKESFVRPLVTTLQQQGLAEKDIFFDDVSIKPGEVIRDRIISTLSSESLELAVVVVSTSFLNKPYWPKL
EFETCLRNNKRIFPIWVDANDDGFKAFSELVGKYSPTLKQMSARRVQKDHVTDEMANIAAEVVQRLSTLGRSTPQPAAIQTLFYLTPSPSPSDSGSSDEE
TRMKDEDTRTPGISYEQWVEDKLKDEKARQLDLLAKLGGIQLDLLKKAEGLLSREEIEKQTKEVLSHLLRSGLDIVKIKMGSAILHLLPNNLLSLNTIWT
AYKSGQLGVDFTGCLVTDEMRAITGHDLAVQVIMLEEQYRQWVEYFNARDMVRTVQEFQSLTMTPDSTTWETFVEEYLEGNTEQIKLLLDTLYIKDTLDK
STNTTILQQLVKNAESVLSLLFSSAAIRFINQSRVVRSVRLCDRSKLKKEESEILSELEANPEEEFVWLFSHLWSDVSDRRFILLLLQCLPLLSAVKNAG
SKSKELNMFNTLLKITVYMSSPGTINSTQMLQLVQTMKHMFSLTDLDLTWFNYEEDDLPLDSQISPSTKYCSTSNRITSPTTMFMSSLPHLACLQDLELD
KCIFISATEVDVLCNSIKGSWQLAKLDITVLLAQWNDAMGAAIGELLPRLSNLKDLRISNRYKESGTALSYVVKHLKTLKKLQKLEIRVHMSDDEAKAVG
VSLQHSECLEELQLNNCKISDIGCTAIAEVFVNKKSLKTLNLSSNQMSLSGAKSFAAHVGNLLCLEDLDLSRNKLSDDGSIVISEAFHKMKSVRHLNLSS
NEISDRGGAVLMGKISLLPNLYRIELRENMMTDAVAQLVVDTVKGMSRPCHVDLSRNCFSSEGVQILKQHHNIWSDVHPERYLHRHTPLETSTSELKPSL
SSPPLSGDEFERRYEMSGVKGEIQGTDTKAAGTRACNV


 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.