Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_050100R:1-1957 050100R_325560_eq Sc0000016:1744487-1755582(-) casp9 caspase 9, apoptosis-related cysteine protease

 Link to be detailed in other pages:
 [transcript: Bb_050100R] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR001315  7-78  4.0E-9  CARD domain
  IPR002182  220-386  6.4E-7  NB-ARC
  IPR001315  844-925  5.1E-10  CARD domain

MEETHKEKLRKNHCRLKGTIRTQHIAGSLKEKGVLTDDDVDRINNEATDEKRTERLLFILARRSSSAFEAFIQSLREVREQGTCLYEDIVQLLEGADPNQ
GTDEDKKWIHVRSKIKEYIAKHLDPKKACDDLTKSHILTEEVADIIQEEKEPFERAMSLLSVLPTTKGQSAFLALCRVLHAQGLEDIVSFLNRASVGDTL
KPVTNVPEPVEYFLETTDATNVEQALQNSNNPSTIVVGGIPKSGKTQITRRIAKKFRHHHPTAVVWALDGQNRQTLLASMRKLLEALNAEVTDEEDITEV
DKCLDQALQNRGTPVLLIVDDLEDGTLLTPTLLRERIQSRVMIPTPQEELQLPAEADVLHISVSGFSTEEVEMFFEANKPKKYKPNQENKPNKEDKPKEE
YQHAFLEALNEAFNHLPLTWASALQFMKISHTSLENFVAQLKEGNTVMDIQEEMKRWMLPHYEKFDPAEESMQLRSAMSKLSSTCWESTSKKSSDGFHSY
GYVLPASSAKEKSNPSSHTQSNPEVDVDTLHPQAPNDQPVSRGDSTIPKLGNSKDRHEEEKHETTLAECEDNDKTSDGTAREINITPSTGPTSAQCQEVP
PCRQLSQEEPTSASNIPIPVLERAVVPPDIDGIQTTHVATRSTEHADTVQERVGGSLENLSHETSAESEHGKVSEYAAALPVEEPRRGSYGASTEAQSFG
SSHCTMTANAPSLQSSLATASQVKQCSRKHAPTSEMDSTSSEEVPLTTPPSERDAPDPNIMAQQQDMAAENIDNSTQLKGPLPTACIEGGIEAEGAVGGR
CSPNPSQAAAQDQTTPSCHSSGRTSIPCREVQNVSRALSIGSGWDLVRRRRTEIARRIKPDLACEYLRNANVLTEDECRGIVEDEDEDEDKATSLLCILP
AKGQEALLAFCAALRDQSLDDIAALITASQVSDILRPITNVPDPVNNFFPTHDANIVRRAVEAVTQHIILVCEVAGSGKTQIARWIAKQFLLHHPTAVVW
ALDGQNSQTLLASMRKLLEALNAQVTDEEDITKVDECLDRALQNRGTPVLRIVDDLEDGTLLTLTPTLLRERIQSRVLILAHQEELQLPDETPWPCNLEG
GFQTWEGVRFFQTVLEEAHYQVNDLQGIADAFNGRPLGLAAALEFMRNTHTSPEHYLFLLKEEQTAWILQEEAQRFMAQHYNKFNERNLHPVFQAAHNKV
RGRRDTSKTDEDTKETCLESPSEYTDDTTSSAQDEQDESPEGQEEEEERMRDEGEGERPTIGSQTQLEEAVSALQLQEEAVESHSPDDQDTQSLSSSLAA
LARSTDGSELEGAVGGIFSPPSHTTSEEEEQKMRDETQSEAAASALWFQEEAIDSHSSDDQLEGAVGGILSPPRSRTASGLPSALASIPPPGPNYARLAV
PCPLVQPATRILCQILRLPEPDIQQAMENLSCSGPPGLIVLENQEFPMLPSAGQLGQEQAMGSVLVFSPASEQLIATEQGQPHQFLWDIASRPGLTREVF
EHVLDSSFTFRYYVPRRPPESLPFVPRDARIGMGTIVQAVAASEGNHWAWRITSTPTGMELEFYMDLESSQGGACGNQRMAAHVAPAGLNPEHRLRRNPH
MQQSSFPPLDTVSLEAERVRLQMHVGQGSISVRIQRGNGAQEIVNLYLQIPSAAACRLDVQFMGESSVDCGGPSRELFVLVWRWLSERYLENGIPRQSPD
LEPATYEFWLAIGRFTLYMFVHYNCFPAAHLARFVVEAMFNGAPQLNREDWLPAFLDTLPTNIRTLLLESCSSETAFERNRASLTEALVAWGVSSFPRSP
AHLSRMLPKIGRSVCLDAPYVALCGLINGFREGWQACVMPGDVDRLIRQHSPPSAGDIIPALDIETSKVDSYTGRRMEGYVHRWLQNASPTMLQQFLITV
TSYDQLTNQNITIVLDPDYPNCVISTCTQTLPVPVVETYEGFCTYMTGALSGDIFNH


 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.