Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_008390R:1-760 008390R_241370_eq Sc0000001:3175568-3181522(-) casp3a caspase 3, apoptosis-related cysteine protease a

 Link to be detailed in other pages:
 [transcript: Bb_008390R] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  PF00656  491-726  5.9E-17  Caspase domain

MSSLMDSFNGDLSPRSHSVANYTKKEAMEDASDEERGVLMQMQEHFYRQALMTEKAKYDKFFREEVSRMLGIAAQRRRQYGLPKKSHESCDTIKALREWI
TWETKRISIHRDNEDENDVVRNLRMLLNRIDYVKILFSDIKRYLITPLLTYFAISAEFNAELLTVRRDLMKGKQQCEKLLSDDYKQITDGQAFEAIPNEK
RFPVLVVVPKAIAILCLITDLTTKWRIHSQFENNLDNLWTRRASLDTPQMLQSKKEEITQLENSVQTAQRDFDEISRDVREFEREAKDAQFSSQYSGTSD
KLEQAEQLVNKLLQEERKLQRKIKSMTERLRSTRVGAVKIRDMLSQSKEQLAKTQEALQTRSEEFEELSSRKKEFDDSEQEFLRGGFDQRRVELMQMKER
QRHAKKKLRQLEDRRERIKQDFRAVREELISLDTEHDKVTQDYDYVKGIMDASLKSLWRDQSPDAISVLPNRMTREKLRTVPIYDIHQPKGICLIISNEI
VRNKAKCRHSVRKDLRGLASLFRQFGYQIVVKENLTSSQIIEALISLSDEYHEFSGRYSSVVVVIMAHGDASGRLVGTDLQPVSVNELTAHFQHTRCPSL
MGQPKMFFIQTCMELVLEAQRLGNPDVPGDISPRRNGFKSTFSLNSFGPLVVTPEEPRLPDNSDFFVAQATVFPPLTTPILTSSLIVQDRSCSPENCFLN
AIVRIFAEYACVEDLLSMMGRVEDCVASTGSHDSYTGRSSPLQMSYVKHTLGKQIFFMPG


 
May 27, 2016. last modified
 
Copyright © Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.