Home APASdb Home APAS Search APAS Browse BLAST Download Contact Us Help Citation
Analysis of genomic poly(A) sites
  Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_v18h27.r3_ref_protein
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>004870F.t1:1-567 name:;chr:scaffold1;start:5371870;end:5374403;strand:+;pro_len:569 Chsy3 chondroitin sulfate synthase 3

 Link to be detailed in other pages:
 [gene: 004870F] [transcript: 004870F.t1] [APASdb: Alternative polyadenylation sties] [Gbrowser: Mapping view

 InterPro protein Families and Domains annotation matched:
 
 InterPro/Pfam Id  Locus  E-value  Description
  IPR008428  201-422  4.2E-52  Chondroitin N-acetylgalactosaminyltransferase
  IPR027791  477-527  3.1E-6  Galactosyltransferase, C-terminal

  1 MTVWLTVLMVPDKNLGQQSVSGHLSEASEQAKIARPDSTHPLKYKGHIYVGVMTAKKYLNSRALATYETWGKQISGKVEFFSATDSKASLGNKIPIVSIP 100
101 RVSDVYPPQKKAFLMLKYMHDHYLDEYEWFVRADDDVYIRGDRLEKFLRKVDSSRAFYIGQAGVGKEDEFGRLGLRPDENYCMGGPGMIMSRETLRRVVP 200
201 NIPWCLKNLYSSHEDVEIGRCITKFAGITCTSAFDTRDIFFNDYKNYNRGNIGELHKAIIDNAITLHPNKRPQYQYKLHTYLLGQRIHDLKRRAFDLHHS 300
301 VEQMTELIEPKLPARAYSQWEKHLKANFHPRETRDVYPWNAVIGKMLYQHATIGGVGPSRRTPTVLKTAMDKNIIQALHTVNREYQRRYRTRCDYSSISH 400
401 GYQRVDPIRGPDYQLDLIVVCRRRQVYFPVMFSQYDPNFADVGGNVGGDQPNRRGGQTAKGYHLFTKDTGYWRFSSYGMACLYREDFTNVGQFDTTIRGW 500
501 GLEDLSLFDKFVKSEVETFRSVDPGLIHVYHPIHCDPNLPAVQYNMCIGSKANTYGSAARLARFWQE 567

 
May 19, 2019. Last updated  
Copyright© Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.