Branchiostoma belcheri haploid   [login][regist]
Home Lancelet Home Gene Search BLAST Genome Browse Download softwares ChangeLog Contact Us Help
 
Genome Project for Chinese Lancelet
 Search For [ Example ] [ Tips ]
  
 Searching for Transcripts 
[Help]  
 
Lancelet
Branchiostoma belcheri
 Database: for
 Tips for searching: search using a ID, gene name, symbols or description variable in publications and databases.
 Searching examples: ssr4, ssr, TLR, caspase, also Bb_073760F are available for query.
 

 1. Transcript Detail Expression Pattern Orthologs among Species [Help]   
 Transcript Mapping
 Exons Structure     

Gene id: Bb_063970F 
Gene name: IFT27
Chromosome: Sc0000024(+)
Gene locus: Sc0000024(+):1168833-1170130
Gene description: Intraflagellar transport protein 27 homolog

Transcript id: Bb_063970F 
Transcript name: IFT27
Transcript locus: Sc0000024(+):1168833-1170130

Start codon: 1168833
Stop codon: 1170128
Alternative polyA sites: Mapped to the searched transcript (containing the 5' and 3' flanking region of 1kb).
1170380, 1170607
polyA signals: ATTAAA, ATTAAA

Notes:
  GO annotation matched    
 GO Id Ontology Term
 QuickGO:0007264  Biological Process  small GTPase mediated signal transduction 
 QuickGO:0005525  Molecular Function  GTP binding 
 QuickGO:0005622  Cellular Component  intracellular 
  InterPro protein Families and Domains annotation matched 
 InterPro Id Term
 InterPro:IPR001806  Ras GTPase 
 InterPro:IPR003577  Ras small GTPase, Ras type 
 InterPro:IPR003578  Small GTPase, Rho type 
 InterPro:IPR003579  Ras small GTPase, Rab type 
 InterPro:IPR005225  Small GTP-binding protein domain 
 InterPro:IPR013753  Ras 
 InterPro:IPR020851  Small GTPase 
  KEGG annotation matched  
 KEGG Id Definition
 KO:K07934   Rab-like protein 
mRNA/CDS:
  mRNA/CDS sequence ( exon splicing-sites gapped by the sympol ' / ' )     
>Bb_063970F 564bp 
ATGGTCGTACTCCGAGCTAAGTGTATCGTGGCAGGTGATTCGACAGTGGGGAAAAGCGCGCTAGTTCAG/ACGTTCCACAGTGATGGGTCCCACTTCCCCAAGAGTTACACCATGACAGAAGGTGTGGAGGTGTGTGTGAAGTCTGTCATCATCCCCGACACCAACGACACCGTGGAGCTGCTGATCTTCGACTCTGCGGGGAAGGAGATCTTCTACGACCACGTGAAGAAGAACTGGGACCACCCGTCTGTCGTGTGCCTAGTGTTCGACCTCACCAGCGAACCATCGTTTCACAG/TTGCTCCAAATGGCTGGAAAGGATTCGCTCCCAGAAGCCAGAAATTGTTCTACCCGGCGTCCTGATTGGCAACAAACTCGACCTAGAGCAGCGGAGAACGGTCACGCCGAAGTTCCCCACGGAATTCGCCTCTTCCCACGGTCTGGAGTACTTTGAGTGCTCGGCCAAGGAACAACAGAACGTAGAGGCTCCGTTTTACTACCTAGCACAAGAGTTTTACAAAATGTATCAGATGAAAGCTGAGGCTATCTCAAGCATGGCAATGTAA
Protein product:
  Amino acids sequence (deduced by the coding sequence)  
> IFT27(Bb_063970F) 188aa
MVVLRAKCIVAGDSTVGKSALVQTFHSDGSHFPKSYTMTEGVEVCVKSVIIPDTNDTVELLIFDSAGKEIFYDHVKKNWDHPSVVCLVFDLTSEPSFHSCSKWLERIRSQKPEIVLPGVLIGNKLDLEQRRTVTPKFPTEFASSHGLEYFECSAKEQQNVEAPFYYLAQEFYKMYQMKAEAISSMAM*
 
Bb_063970F IFT27 ,Intraflagellar transport protein 27 homolog.
 
 
 
October 24, 2017. last modified
 
 
 
Published Papers Resear Directions Tools & Resources Others    
Bioinformatics
Amphioxus
Zebrafish
Drug Design
Conotoxin
Human MHC
Amphioxus Immunity
Zebrafish Immunity
Drug Design
Conotoxin
Human MHC
Bioinformatics
Softwares & Tools
Data & Download
APASdb Database
 
 
 
About Supervisor
Laboratory Site
 
 
 
 
   


Copyright©Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.