Branchiostoma belcheri haploid   [login][regist]
Home Lancelet Home Gene Search BLAST Genome Browse Download softwares ChangeLog Contact Us Help
 
Genome Project for Chinese Lancelet
 Search For [ Example ] [ Tips ]
Sequence obtained by querying the dataset: Proteins/B.belcheri_HapV2(v7h2)_proteins
Strand:  Forwstrand Revcstrand  Display:  Fasta Numbered
Current detected sequences from to

>Bb_073760F:1-172 073760F_061290_eq Sc0000031:1764674-1771073(+) ssr4 signal sequence receptor, delta
 [transcript:Bb_073760F] [APASdb:APA sites] [Gbrowser:Mapping view] 
MASWTKMFALFSLVLLFFCSSNAQTCVGPTVEATSFTSAEANLAMETTFLVEFTLSCKNAAKDLVLHADIGDRQFPVSRSADGMRYQISWTAEHKQAPAG
SYEVRFFDDEGFAALRKAQRSDQDVNAVSSLFTITVHHRGVSQGPWASSPTVAAVAAFAVWLFAYRAKRQIQ


October 24, 2017. last modified
 
 
 
Published Papers Resear Directions Tools & Resources Others    
Bioinformatics
Amphioxus
Zebrafish
Drug Design
Conotoxin
Human MHC
Amphioxus Immunity
Zebrafish Immunity
Drug Design
Conotoxin
Human MHC
Bioinformatics
Softwares & Tools
Data & Download
APASdb Database
 
 
 
About Supervisor
Laboratory Site
 
 
 
 
   


Copyright©Laboratory of Molecular Medicine, Sun Yat-Sen University, High Education Mega Center, Guangzhou 510006 China.